HOPX (NM_139211) Human Recombinant Protein

CAT#: TP304361

Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2

Product Images

Coomassie blue staining of purified HOPX protein (Cat# TP304361). The protein was produced from HEK293T cells transfected with HOPX cDNA clone (Cat# RC204361) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204361 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS
  VID
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_631957
• Locus ID: 84525
• UniProt ID: Q9BPY8
• Cytogenetics: 4q12
• Refseq Size: 1154
• Refseq ORF: 219
• Synonyms: CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO
• Summary: The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009]
• Protein Families: Transcription Factors