DHPS (NM_013407) Human Mass Spec Standard

CAT#: PH322934

DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539)

Product Images

Coomassie blue staining of purified DHPS protein (Cat# TP322934). The protein was produced from HEK293T cells transfected with DHPS cDNA clone (Cat# RC222934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222934
• Predicted MW: 34.8 kDa
• Protein Sequence:
  Sequence Link

  >RC222934 representing NM_013407
  Red=Cloning site Green=Tags(s)
  
  MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI
  EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI
  KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL
  GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEGARPDEAVSWGKIRVDAQP
  VKVYADASLVFPLLVAETFAQKMDAFMHEKNED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037539
• RefSeq Size: 1183
• RefSeq ORF: 939
• Synonyms: DHS; MIG13
• Locus ID: 1725
• Cytogenetics: 19p13.13
• Summary: 'This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]'