DHPS (NM_013407) Human Mass Spec Standard
CAT#: PH322934
DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222934 |
Predicted MW | 34.8 kDa |
Protein Sequence |
>RC222934 representing NM_013407
Red=Cloning site Green=Tags(s) MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEGARPDEAVSWGKIRVDAQP VKVYADASLVFPLLVAETFAQKMDAFMHEKNED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037539 |
RefSeq Size | 1183 |
RefSeq ORF | 939 |
Synonyms | DHS; MIG13 |
Locus ID | 1725 |
Cytogenetics | 19p13.13 |
Summary | 'This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400714 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415606 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400714 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 1 |
USD 325.00 |
|
LY415606 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 3 |
USD 325.00 |
|
PH304235 | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_001921) |
USD 2,055.00 |
|
TP304235 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 |
USD 823.00 |
|
TP322934 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 3 |
USD 748.00 |
|
TP720110 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review