Aminoadipate aminotransferase (AADAT) (NM_016228) Human Mass Spec Standard

CAT#: PH323277

AADAT MS Standard C13 and N15-labeled recombinant protein (NP_057312)

Product Images

Coomassie blue staining of purified AADAT protein (Cat# TP323277). The protein was produced from HEK293T cells transfected with AADAT cDNA clone (Cat# RC223277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223277
• Predicted MW: 47.2 kDa
• Protein Sequence:
  Sequence Link

  >RC223277 representing NM_016228
  Red=Cloning site Green=Tags(s)
  
  MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR
  ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP
  AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS
  ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL
  IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP
  AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
  IKESL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057312
• RefSeq Size: 2326
• RefSeq ORF: 1275
• Synonyms: KAT2; KATII; KYAT2
• Locus ID: 51166
• UniProt ID: Q8N5Z0, Q4W5N8
• Cytogenetics: 4q33
• Summary: This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
• Protein Pathways: Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism