Macrophage Scavenger Receptor I (MSR1) (NM_138716) Human Mass Spec Standard
CAT#: PH323314
MSR1 MS Standard C13 and N15-labeled recombinant protein (NP_619730)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223314 |
| Predicted MW | 42.8 kDa |
| Protein Sequence |
>RC223314 representing NM_138716
Red=Cloning site Green=Tags(s) MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLSTGPIW LNEVFCFGRESSIEECKIRQWGTRACSHSEDAGVTCTL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_619730 |
| RefSeq Size | 3493 |
| RefSeq ORF | 1164 |
| Synonyms | CD204; phSR1; phSR2; SCARA1; SR-A; SR-AI; SR-AII; SR-AIII; SRA |
| Locus ID | 4481 |
| UniProt ID | P21757 |
| Cytogenetics | 8p22 |
| Summary | 'This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403366 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408527 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419319 | MSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403366 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AI |
USD 436.00 |
|
| LY408527 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AIII |
USD 436.00 |
|
| LY419319 | Transient overexpression lysate of macrophage scavenger receptor 1 (MSR1), transcript variant SR-AII |
USD 436.00 |
|
| PH312931 | MSR1 MS Standard C13 and N15-labeled recombinant protein (NP_002436) |
USD 2,055.00 |
|
| TP312931 | Recombinant protein of human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AII |
USD 439.00 |
|
| TP323314 | Recombinant protein of human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AIII |
USD 748.00 |
|
| TP761290 | Purified recombinant protein of Human macrophage scavenger receptor 1 (MSR1), transcript variant SR-AI, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China