RNF14 (NM_183400) Human Mass Spec Standard
CAT#: PH323362
RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899647)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223362 |
Predicted MW | 53.7 kDa |
Protein Sequence |
>RC223362 representing NM_183400
Red=Cloning site Green=Tags(s) MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_899647 |
RefSeq Size | 2970 |
RefSeq ORF | 1422 |
Synonyms | ARA54; HFB30; HRIHFB2038; TRIAD2 |
Locus ID | 9604 |
UniProt ID | Q9UBS8 |
Cytogenetics | 5q31.3 |
Summary | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405271 | RNF14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY405271 | Transient overexpression lysate of ring finger protein 14 (RNF14), transcript variant 4 |
USD 605.00 |
|
PH323304 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281) |
USD 2,055.00 |
|
PH323420 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648) |
USD 2,055.00 |
|
PH323491 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) |
USD 2,055.00 |
|
TP323304 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1 |
USD 788.00 |
|
TP323362 | Recombinant protein of human ring finger protein 14 (RNF14), transcript variant 4 |
USD 748.00 |
|
TP323420 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 5 |
USD 748.00 |
|
TP323491 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review