ketohexokinase (KHK) (NM_006488) Human Mass Spec Standard

CAT#: PH323488

KHK MS Standard C13 and N15-labeled recombinant protein (NP_006479)

Product Images

Coomassie blue staining of purified KHK protein (Cat# TP323488). The protein was produced from HEK293T cells transfected with KHK cDNA clone (Cat# RC223488) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223488
• Predicted MW: 32.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223488 representing NM_006488
  Red=Cloning site Green=Tags(s)
  
  MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVAD
  FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEG
  RNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG
  LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRF
  GCQVAGKKCGLQGFDGIV
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006479
• RefSeq Size: 1899
• RefSeq ORF: 894
• Synonyms: ketohexokinase; ketohexokinase (fructokinase)
• Locus ID: 3795
• UniProt ID: P50053
• Cytogenetics: 2p23.3
• Summary: 'This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways