Cathepsin L (CTSL) (NM_145918) Human Mass Spec Standard
CAT#: PH323541
CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_666023)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223541 |
| Predicted MW | 37.5 kDa |
| Protein Sequence |
>RC223541 protein sequence
Red=Cloning site Green=Tags(s) MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGK HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_666023 |
| RefSeq Size | 1587 |
| RefSeq ORF | 999 |
| Synonyms | CATL; CTSL1; MEP |
| Locus ID | 1514 |
| UniProt ID | P07711, A0A024R276 |
| Cytogenetics | 9q21.33 |
| Summary | 'The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell. [provided by RefSeq, Aug 2020]' |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Antigen processing and presentation, Lysosome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400711 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407805 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400711 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 1 |
USD 436.00 |
|
| LY407805 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 2 |
USD 436.00 |
|
| PH303143 | CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_001903) |
USD 2,055.00 |
|
| TP303143 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 1 |
USD 823.00 |
|
| TP323541 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 2 |
USD 748.00 |
|
| TP720657 | Purified recombinant protein of Human cathepsin L1 (CTSL1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China