NOR1 (NR4A3) (NM_173200) Human Mass Spec Standard
CAT#: PH323629
NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223629 |
| Predicted MW | 69.3 kDa |
| Protein Sequence |
>RC223629 representing NM_173200
Red=Cloning site Green=Tags(s) MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIS TFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLP STSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPH PPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASS LLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGL KEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKL FLDTLPF myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_775292 |
| RefSeq Size | 4983 |
| RefSeq ORF | 1911 |
| Synonyms | CHN; CSMF; MINOR; NOR1; TEC |
| Locus ID | 8013 |
| UniProt ID | Q92570 |
| Cytogenetics | 9q31.1 |
| Summary | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406643 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC416280 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429326 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430394 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY406643 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 |
USD 665.00 |
|
| LY416280 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
USD 665.00 |
|
| LY429326 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
USD 396.00 |
|
| LY430394 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 |
USD 396.00 |
|
| TP323629 | Recombinant protein of human nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 3 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China