IFNA4 (NM_021068) Human Mass Spec Standard

CAT#: PH323649

IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546)

Product Images

Coomassie blue staining of purified IFNA4 protein (Cat# TP323649). The protein was produced from HEK293T cells transfected with IFNA4 cDNA clone (Cat# RC223649) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223649
• Predicted MW: 21.8 kDa
• Protein Sequence:
  Sequence Link

  >RC223649 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQ
  FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI
  LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066546
• RefSeq Size: 982
• RefSeq ORF: 567
• Synonyms: IFN-alpha4a; INFA4
• Locus ID: 3441
• UniProt ID: P05014
• Cytogenetics: 9p21.3
• Summary: ''
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway