RUNX1 (NM_001001890) Human Mass Spec Standard

CAT#: PH323854

RUNX1 MS Standard C13 and N15-labeled recombinant protein (NP_001001890)

Product Images

Coomassie blue staining of purified RUNX1 protein (Cat# TP323854). The protein was produced from HEK293T cells transfected with RUNX1 cDNA clone (Cat# RC223854) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223854
• Predicted MW: 48.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223854 representing NM_001001890
  Red=Cloning site Green=Tags(s)
  
  MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF
  LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS
  GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR
  VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA
  SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY
  HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
  NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001890
• RefSeq Size: 7288
• RefSeq ORF: 1359
• Synonyms: AML1; AML1-EVI-1; AMLCR1; CBF2alpha; CBFA2; EVI-1; PEBP2aB; PEBP2alpha
• Locus ID: 861
• UniProt ID: Q01196
• Cytogenetics: 21q22.12
• Summary: 'Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Chronic myeloid leukemia, Pathways in cancer