SERPINB8 (NM_002640) Human Mass Spec Standard

CAT#: PH323880

SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_002631)

Product Images

Coomassie blue staining of purified SERPINB8 protein (Cat# TP323880). The protein was produced from HEK293T cells transfected with SERPINB8 cDNA clone (Cat# RC223880) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223880
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223880 representing NM_002640
  Red=Cloning site Green=Tags(s)
  
  MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF
  QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT
  EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE
  VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE
  PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD
  HPFLFFIRRHKTNCILFCGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002631
• RefSeq Size: 3390
• RefSeq ORF: 1122
• Synonyms: C18orf53; CAP2; PI-8; PI8; PSS5
• Locus ID: 5271
• UniProt ID: P50452, A0A024R2B1
• Cytogenetics: 18q22.1
• Summary: 'The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis. [provided by RefSeq, Jan 2017]'
• Protein Families: Druggable Genome