SERPINB8 (NM_001031848) Human Recombinant Protein

CAT#: TP305135

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3

Product Images

Coomassie blue staining of purified SERPINB8 protein (Cat# TP305135). The protein was produced from HEK293T cells transfected with SERPINB8 cDNA clone (Cat# RC205135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF
  QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT
  EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE
  VHTQVLELPYVEEELSMVILLPDDNTDLAVKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001027018
• Locus ID: 5271
• UniProt ID: P50452, Q8N178
• Cytogenetics: 18q22.1
• Refseq Size: 1409
• Refseq ORF: 726
• Synonyms: C18orf53; CAP2; PI-8; PI8; PSS5
• Summary: The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis. [provided by RefSeq, Jan 2017]
• Protein Families: Druggable Genome