SCN4B (NM_174934) Human Mass Spec Standard

CAT#: PH323951

SCN4B MS Standard C13 and N15-labeled recombinant protein (NP_777594)

Product Images

Coomassie blue staining of purified SCN4B protein (Cat# TP323951). The protein was produced from HEK293T cells transfected with SCN4B cDNA clone (Cat# RC223951) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223951
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC223951 representing NM_174934
  Red=Cloning site Green=Tags(s)
  
  MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY
  NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN
  LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN
  TENGLPGSKAEEKPPSKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_777594
• RefSeq Size: 4489
• RefSeq ORF: 684
• Synonyms: ATFB17; LQT10; Navbeta4
• Locus ID: 6330
• UniProt ID: Q8IWT1, B0YJ93
• Cytogenetics: 11q23.3
• Summary: 'The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.[provided by RefSeq, Mar 2009]'
• Protein Families: Ion Channels: Sodium, Transmembrane