PD L2 (PDCD1LG2) (NM_025239) Human Mass Spec Standard

CAT#: PH324141

PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515)

Product Images

Coomassie blue staining of purified PDCD1LG2 protein (Cat# TP324141). The protein was produced from HEK293T cells transfected with PDCD1LG2 cDNA clone (Cat# RC224141) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224141
• Predicted MW: 30.8 kDa
• Protein Sequence:
  Sequence Link

  >RC224141 representing NM_025239
  Red=Cloning site Green=Tags(s)
  
  MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR
  ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE
  LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
  SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079515
• RefSeq Size: 1518
• RefSeq ORF: 819
• Synonyms: B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
• Locus ID: 80380
• UniProt ID: Q9BQ51
• Cytogenetics: 9p24.1
• Summary: Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)