PD L2 (PDCD1LG2) (NM_025239) Human Mass Spec Standard
CAT#: PH324141
PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224141 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079515 |
RefSeq Size | 1518 |
RefSeq ORF | 819 |
Synonyms | B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2 |
Locus ID | 80380 |
UniProt ID | Q9BQ51 |
Cytogenetics | 9p24.1 |
Summary | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410802 | PDCD1LG2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410802 | Transient overexpression lysate of programmed cell death 1 ligand 2 (PDCD1LG2) |
USD 396.00 |
|
TP324141 | Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2) |
USD 823.00 |
|
TP700202 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain expressed in human cells, 20 µg |
USD 748.00 |
|
TP700203 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
USD 748.00 |
|
TP720737 | Purified recombinant protein of Human programmed cell death 1 ligand 2 (PDCD1LG2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review