PD L2 (PDCD1LG2) (NM_025239) Human Recombinant Protein

CAT#: TP324141

Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2)

Product Images

Coomassie blue staining of purified PDCD1LG2 protein (Cat# TP324141). The protein was produced from HEK293T cells transfected with PDCD1LG2 cDNA clone (Cat# RC224141) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224141 representing NM_025239
  Red=Cloning site Green=Tags(s)
  
  MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR
  ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE
  LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
  SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079515
• Locus ID: 80380
• UniProt ID: Q9BQ51
• Cytogenetics: 9p24.1
• Refseq Size: 1518
• Refseq ORF: 819
• Synonyms: B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
• Summary: Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)