WWP2 (NM_199423) Human Mass Spec Standard
CAT#: PH324229
WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_955455)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224229 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC224229 representing NM_199423
Red=Cloning site Green=Tags(s) MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEI IILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIF LDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQ SPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAE GEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_955455 |
RefSeq Size | 2659 |
RefSeq ORF | 1005 |
Synonyms | AIP2; WWp2-like |
Locus ID | 11060 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402076 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404555 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430830 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402076 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 1 |
USD 396.00 |
|
LY404555 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 396.00 |
|
LY430830 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 396.00 |
|
PH309529 | WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_955456) |
USD 2,055.00 |
|
PH323118 | WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_008945) |
USD 2,055.00 |
|
TP309529 | Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 2 |
USD 823.00 |
|
TP323118 | Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 1 |
USD 748.00 |
|
TP324229 | Purified recombinant protein of Homo sapiens WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review