WWP2 (NM_199424) Human Recombinant Protein
CAT#: TP309529
Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 2
View other "WWP2" proteins (11)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209529 protein sequence
Red=Cloning site Green=Tags(s) MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEI IILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIF LDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQ SPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAE GEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVD HNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGA YDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIA REWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPF YKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEEN KEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYT KNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN RLDLPPYKSYEQLREKLLYAIEETEGFGQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955456 |
Locus ID | 11060 |
UniProt ID | O00308, B4DHF6 |
Cytogenetics | 16q22.1 |
Refseq Size | 3700 |
Refseq ORF | 2613 |
Synonyms | AIP2; WWp2-like |
Summary | This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402076 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404555 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430830 | WWP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402076 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 1 |
USD 396.00 |
|
LY404555 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 396.00 |
|
LY430830 | Transient overexpression lysate of WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 396.00 |
|
PH309529 | WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_955456) |
USD 2,055.00 |
|
PH323118 | WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_008945) |
USD 2,055.00 |
|
PH324229 | WWP2 MS Standard C13 and N15-labeled recombinant protein (NP_955455) |
USD 2,055.00 |
|
TP323118 | Recombinant protein of human WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 1 |
USD 748.00 |
|
TP324229 | Purified recombinant protein of Homo sapiens WW domain containing E3 ubiquitin protein ligase 2 (WWP2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review