N42L1 (N4BP2L1) (NM_052818) Human Mass Spec Standard

CAT#: PH324407

N4BP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_438169)

Product Images

Coomassie blue staining of purified N4BP2L1 protein (Cat# TP324407). The protein was produced from HEK293T cells transfected with N4BP2L1 cDNA clone (Cat# RC224407) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224407
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC224407 representing NM_052818
  Red=Cloning site Green=Tags(s)
  
  MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRAL
  IFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEV
  IFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNAR
  YWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_438169
• RefSeq Size: 3051
• RefSeq ORF: 729
• Synonyms: CG018
• Locus ID: 90634
• UniProt ID: Q5TBK1, A0A024RDR5
• Cytogenetics: 13q13.1