BLOC1S1 (NM_001487) Human Mass Spec Standard

CAT#: PH324412

BLOC1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001478)

Product Images

Coomassie blue staining of purified BLOC1S1 protein (Cat# TP324412). The protein was produced from HEK293T cells transfected with BLOC1S1 cDNA clone (Cat# RC224412) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224412
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Sequence Link

  >RC224412 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
  AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001478
• RefSeq Size: 590
• RefSeq ORF: 375
• Synonyms: BLOS1; BORCS1; GCN5L1; MICoA; RT14
• Locus ID: 2647
• UniProt ID: P78537
• Cytogenetics: 12q13.2
• Summary: 'BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]'