PFTK1 (CDK14) (NM_012395) Human Mass Spec Standard

CAT#: PH324426

CDK14 MS Standard C13 and N15-labeled recombinant protein (NP_036527)

Product Images

Coomassie blue staining of purified CDK14 protein (Cat# TP324426). The protein was produced from HEK293T cells transfected with CDK14 cDNA clone (Cat# RC224426) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224426
• Predicted MW: 50.5 kDa
• Protein Sequence:
  Sequence Link

  >RC224426 representing NM_012395
  Red=Cloning site Green=Tags(s)
  
  MHGYFGCNAAAEPGYSAFVGTPQICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPAN
  QVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
  KLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGL
  HPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYR
  PPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP
  ERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTV
  PNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036527
• RefSeq Size: 4953
• RefSeq ORF: 1353
• Synonyms: PFTAIRE1; PFTK1
• Locus ID: 5218
• UniProt ID: O94921
• Cytogenetics: 7q21.13
• Summary: PFTK1 is a member of the CDC2 (MIM 116940)-related protein kinase family (Yang and Chen, 2001 [PubMed 11313143]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase