C21ORF56 (SPATC1L) (NM_032261) Human Mass Spec Standard
CAT#: PH324562
C21orf56 MS Standard C13 and N15-labeled recombinant protein (NP_115637)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224562 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC224562 protein sequence
Red=Cloning site Green=Tags(s) MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVA NIPEKIEQTSTKSLDGSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRAN PLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115637 |
RefSeq Size | 1181 |
RefSeq ORF | 558 |
Synonyms | C21orf56 |
Locus ID | 84221 |
UniProt ID | Q9H0A9 |
Cytogenetics | 21q22.3 |
Summary | Belongs to the speriolin family. [UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410249 | SPATC1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428289 | SPATC1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410249 | Transient overexpression lysate of chromosome 21 open reading frame 56 (C21orf56), transcript variant 2 |
USD 396.00 |
|
LY428289 | Transient overexpression lysate of chromosome 21 open reading frame 56 (C21orf56), transcript variant 1 |
USD 396.00 |
|
TP324562 | Recombinant protein of human chromosome 21 open reading frame 56 (C21orf56), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review