Cyt 19 (AS3MT) (NM_020682) Human Mass Spec Standard

CAT#: PH324597

AS3MT MS Standard C13 and N15-labeled recombinant protein (NP_065733)

Product Images

Coomassie blue staining of purified AS3MT protein (Cat# TP324597). The protein was produced from HEK293T cells transfected with AS3MT cDNA clone (Cat# RC224597) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224597
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224597 representing NM_020682
  Red=Cloning site Green=Tags(s)
  
  MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE
  NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG
  EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA
  LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT
  GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA
  EESDSMKSRCVPDAAGGCCGTKKSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065733
• RefSeq Size: 2477
• RefSeq ORF: 1125
• Synonyms: CYT19
• Locus ID: 57412
• UniProt ID: Q9HBK9
• Cytogenetics: 10q24.32
• Summary: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome