TMEM80 (NM_001042463) Human Mass Spec Standard

CAT#: PH324685

TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_001035928)

Product Images

Coomassie blue staining of purified TMEM80 protein (Cat# TP324685). The protein was produced from HEK293T cells transfected with TMEM80 cDNA clone (Cat# RC224685) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224685
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC224685 representing NM_001042463
  Red=Cloning site Green=Tags(s)
  
  MAEGARARGPRGCRDRDGPAGGAGKMAAPRRGRGSSTVLSSVPLQMLFYLSGTYYALYFLATLLMITYKS
  QVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWA
  DWALSATLLALHGLEAVLQVVAIAAFTR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035928
• RefSeq Size: 1637
• RefSeq ORF: 504
• Synonyms: FLJ38216; FLJ55823
• Locus ID: 283232
• UniProt ID: Q96HE8
• Cytogenetics: 11p15.5
• Protein Families: Transmembrane