TMEM80 (NM_174940) Human Recombinant Protein
CAT#: TP302288
Recombinant protein of human transmembrane protein 80 (TMEM80), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202288 protein sequence
Red=Cloning site Green=Tags(s) MAEGARARGPRGCRDRDGPAGGAGRGSSTVLSSVPLQMLFYLSGTYYALYFLATLLMITYKSQVFSYPHR YLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWADWALSATL LALHGLEAVLQVVAIAAFTR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_777600 |
Locus ID | 283232 |
UniProt ID | Q96HE8 |
Cytogenetics | 11p15.5 |
Refseq Size | 1638 |
Refseq ORF | 480 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406341 | TMEM80 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406341 | Transient overexpression lysate of transmembrane protein 80 (TMEM80), transcript variant 1 |
USD 396.00 |
|
PH302288 | TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_777600) |
USD 2,055.00 |
|
PH324685 | TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_001035928) |
USD 2,055.00 |
|
TP324685 | Purified recombinant protein of Homo sapiens transmembrane protein 80 (TMEM80), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review