ARL9 (NM_206919) Human Mass Spec Standard

CAT#: PH324926

ARL9 MS Standard C13 and N15-labeled recombinant protein (NP_996802)

Product Images

Coomassie blue staining of purified ARL9 protein (Cat# TP324926). The protein was produced from HEK293T cells transfected with ARL9 cDNA clone (Cat# RC224926) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224926
• Predicted MW: 13.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224926 representing NM_206919
  Red=Cloning site Green=Tags(s)
  
  MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAY
  HITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996802
• RefSeq Size: 836
• RefSeq ORF: 369
• Synonyms: ADP-ribosylation factor-like 9
• Locus ID: 132946
• UniProt ID: Q6T311
• Cytogenetics: 4q12
• Summary: ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily. [supplied by OMIM, Nov 2008]