ING4 (NM_001127586) Human Mass Spec Standard

CAT#: PH325191

ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058)

Product Images

Coomassie blue staining of purified ING4 protein (Cat# TP325191). The protein was produced from HEK293T cells transfected with ING4 cDNA clone (Cat# RC225191) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225191
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC225191 representing NM_001127586
  Red=Cloning site Green=Tags(s)
  
  MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
  AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
  ARARSKGKNSDEEAPKTAQKKLKLVRTVPLSGSILPVWG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001121058
• RefSeq ORF: 537
• Synonyms: my036; p29ING4
• Locus ID: 51147
• UniProt ID: Q9UNL4
• Cytogenetics: 12p13.31
• Summary: This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors