ING4 (NM_001127586) Human Mass Spec Standard
CAT#: PH325191
ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225191 |
Predicted MW | 20.3 kDa |
Protein Sequence |
>RC225191 representing NM_001127586
Red=Cloning site Green=Tags(s) MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTVPLSGSILPVWG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001121058 |
RefSeq ORF | 537 |
Synonyms | my036; p29ING4 |
Locus ID | 51147 |
UniProt ID | Q9UNL4 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402512 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426813 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402512 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 |
USD 396.00 |
|
LY426813 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 |
USD 396.00 |
|
PH302827 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) |
USD 2,055.00 |
|
TP302827 | Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1 |
USD 823.00 |
|
TP325191 | Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review