ING4 (NM_016162) Human Recombinant Protein
CAT#: TP302827
Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202827 protein sequence
Red=Cloning site Green=Tags(s) MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057246 |
| Locus ID | 51147 |
| UniProt ID | Q9UNL4 |
| Cytogenetics | 12p13.31 |
| Refseq Size | 1458 |
| Refseq ORF | 747 |
| Synonyms | my036; p29ING4 |
| Summary | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402512 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426813 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402512 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 |
USD 436.00 |
|
| LY426813 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 |
USD 436.00 |
|
| PH302827 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) |
USD 2,055.00 |
|
| PH325191 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) |
USD 2,055.00 |
|
| TP325191 | Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China