SYCE2 (NM_001105578) Human Mass Spec Standard

CAT#: PH325261

SYCE2 MS Standard C13 and N15-labeled recombinant protein (NP_001099048)

Product Images

Coomassie blue staining of purified SYCE2 protein (Cat# TP325261). The protein was produced from HEK293T cells transfected with SYCE2 cDNA clone (Cat# RC225261) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225261
• Predicted MW: 24.5 kDa
• Protein Sequence:
  Sequence Link

  >RC225261 representing NM_001105578
  Red=Cloning site Green=Tags(s)
  
  MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL
  QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS
  HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV
  QTNRDGEC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001099048
• RefSeq ORF: 654
• Synonyms: CESC1
• Locus ID: 256126
• UniProt ID: Q6PIF2
• Cytogenetics: 19p13.13
• Summary: The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by RefSeq, Dec 2012]