Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Mass Spec Standard
CAT#: PH325345
BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_001120712)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225345 |
Predicted MW | 26.3 kDa |
Protein Sequence |
>RC225345 representing NM_001127240
Red=Cloning site Green=Tags(s) MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSV LRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGV ARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHH GTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001120712 |
RefSeq ORF | 783 |
Synonyms | JFY-1; JFY1; PUMA |
Locus ID | 27113 |
UniProt ID | Q9BXH1, Q96PG8 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Huntington's disease, p53 signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402330 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426734 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402330 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 |
USD 396.00 |
|
LY426734 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 1 |
USD 396.00 |
|
PH313203 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232) |
USD 2,055.00 |
|
TP313203 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 4 |
USD 748.00 |
|
TP325345 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review