MSF (SEPT9) (NM_001113496) Human Mass Spec Standard

CAT#: PH325490

SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968)

Product Images

Coomassie blue staining of purified SEPTIN9 protein (Cat# TP325490). The protein was produced from HEK293T cells transfected with SEPTIN9 cDNA clone (Cat# RC225490) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225490
• Predicted MW: 38.3 kDa
• Protein Sequence:
  Sequence Link

  >RC225490 representing NM_001113496
  Red=Cloning site Green=Tags(s)
  
  MADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKS
  KISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYL
  QEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRI
  TADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHC
  EFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001106968
• RefSeq ORF: 1005
• Synonyms: AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1
• Locus ID: 10801
• UniProt ID: Q9UHD8
• Cytogenetics: 17q25.3
• Summary: This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome