MSF (SEPT9) (NM_006640) Human Recombinant Protein
CAT#: TP300264
Recombinant protein of human septin 9 (SEPT9), transcript variant 3
View other "SEPTIN9" proteins (13)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200264 protein sequence
Red=Cloning site Green=Tags(s) MERDRISALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKA SLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQ ESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQ PPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFE FNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGD HINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVN IVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQV NGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGVEE KEPEAPEM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006631 |
Locus ID | 10801 |
UniProt ID | Q9UHD8, A0A0S2Z5A5 |
Cytogenetics | 17q25.3 |
Refseq Size | 4469 |
Refseq ORF | 1704 |
Synonyms | AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1 |
Summary | This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401986 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426417 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426419 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426421 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426422 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401986 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 3 |
USD 396.00 |
|
LY426417 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 1 |
USD 396.00 |
|
LY426419 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 2 |
USD 396.00 |
|
LY426421 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 4 |
USD 396.00 |
|
LY426422 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 7 |
USD 396.00 |
|
PH300264 | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631) |
USD 2,055.00 |
|
PH325490 | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968) |
USD 2,055.00 |
|
TP325490 | Purified recombinant protein of Homo sapiens septin 9 (SEPT9), transcript variant 7 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review