alpha 1 Antitrypsin (SERPINA1) (NM_001127706) Human Mass Spec Standard
CAT#: PH325663
SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121178)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225663 |
Predicted MW | 46.7 kDa |
Protein Sequence |
>RC225663 protein sequence
Red=Cloning site Green=Tags(s) MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001121178 |
RefSeq Size | 3303 |
RefSeq ORF | 1254 |
Synonyms | A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275 |
Locus ID | 5265 |
UniProt ID | P01009, E9KL23 |
Cytogenetics | 14q32.13 |
Summary | 'The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400112 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424179 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426858 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426859 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426860 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426861 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426862 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426863 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426864 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426865 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400112 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 |
USD 325.00 |
|
LY424179 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
USD 495.00 |
|
LY426858 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
USD 325.00 |
|
LY426859 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
USD 325.00 |
|
LY426860 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
USD 325.00 |
|
LY426861 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
USD 325.00 |
|
LY426862 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
USD 325.00 |
|
LY426863 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
USD 325.00 |
|
LY426864 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
USD 325.00 |
|
LY426865 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
USD 325.00 |
|
PH302082 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286) |
USD 2,055.00 |
|
PH321489 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001002236) |
USD 2,055.00 |
|
PH325656 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121173) |
USD 2,055.00 |
|
PH325657 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121174) |
USD 2,055.00 |
|
PH325658 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121175) |
USD 2,055.00 |
|
PH325659 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121176) |
USD 2,055.00 |
|
PH325661 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121177) |
USD 2,055.00 |
|
PH325664 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121179) |
USD 2,055.00 |
|
PH325668 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) |
USD 2,055.00 |
|
TP302082 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 |
USD 867.00 |
|
TP321489 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
USD 748.00 |
|
TP325656 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
USD 748.00 |
|
TP325657 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
USD 748.00 |
|
TP325658 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
USD 748.00 |
|
TP325659 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
USD 748.00 |
|
TP325661 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
USD 748.00 |
|
TP325663 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
USD 748.00 |
|
TP325664 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
USD 748.00 |
|
TP325668 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
USD 748.00 |
|
TP701025 | Purified protein of human z-type alpha-1-antitrypsin protein Glu342Lys mutant, Tag Free, secretory expressed in HEK cells, 50ug |
USD 748.00 |
|
TP760123 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review