alpha 1 Antitrypsin (SERPINA1) (NM_000295) Human Recombinant Protein
CAT#: TP302082
Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202082 protein sequence
Red=Cloning site Green=Tags(s) MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | In vivo treatment (PMID: 26265629) In vivo treatment (PMID: 27936229) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000286 |
| Locus ID | 5265 |
| UniProt ID | P01009, E9KL23 |
| Cytogenetics | 14q32.13 |
| Refseq Size | 3220 |
| Refseq ORF | 1254 |
| Synonyms | A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275 |
| Summary | The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400112 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424179 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC426858 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426859 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426860 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426861 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426862 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426863 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426864 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426865 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400112 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 |
USD 436.00 |
|
| LY424179 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
USD 665.00 |
|
| LY426858 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
USD 436.00 |
|
| LY426859 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
USD 436.00 |
|
| LY426860 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
USD 436.00 |
|
| LY426861 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
USD 436.00 |
|
| LY426862 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
USD 436.00 |
|
| LY426863 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
USD 436.00 |
|
| LY426864 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
USD 436.00 |
|
| LY426865 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
USD 436.00 |
|
| PH302082 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286) |
USD 2,055.00 |
|
| PH321489 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001002236) |
USD 2,055.00 |
|
| PH325656 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121173) |
USD 2,055.00 |
|
| PH325657 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121174) |
USD 2,055.00 |
|
| PH325658 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121175) |
USD 2,055.00 |
|
| PH325659 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121176) |
USD 2,055.00 |
|
| PH325661 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121177) |
USD 2,055.00 |
|
| PH325663 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121178) |
USD 2,055.00 |
|
| PH325664 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121179) |
USD 2,055.00 |
|
| PH325668 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) |
USD 2,055.00 |
|
| TP321489 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
USD 748.00 |
|
| TP325656 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
USD 748.00 |
|
| TP325657 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
USD 748.00 |
|
| TP325658 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
USD 748.00 |
|
| TP325659 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
USD 748.00 |
|
| TP325661 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
USD 748.00 |
|
| TP325663 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
USD 748.00 |
|
| TP325664 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
USD 748.00 |
|
| TP325668 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
USD 748.00 |
|
| TP701025 | Purified protein of human z-type alpha-1-antitrypsin protein Glu342Lys mutant, Tag Free, secretory expressed in HEK cells, 50ug |
USD 748.00 |
|
| TP760123 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China