RACGAP1 (NM_001126104) Human Mass Spec Standard
CAT#: PH326046
RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226046 |
Predicted MW | 71 kDa |
Protein Sequence |
>RC226046 protein sequence
Red=Cloning site Green=Tags(s) MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM LK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001119576 |
RefSeq Size | 3206 |
RefSeq ORF | 1896 |
Synonyms | CYK4; HsCYK-4; ID-GAP; MgcRacGAP |
Locus ID | 29127 |
UniProt ID | Q9H0H5, A0A024R136 |
Cytogenetics | 12q13.12 |
Summary | This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402238 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426645 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426646 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402238 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 |
USD 396.00 |
|
LY426645 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 |
USD 396.00 |
|
LY426646 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 |
USD 396.00 |
|
PH307542 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409) |
USD 2,055.00 |
|
PH326045 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) |
USD 2,055.00 |
|
TP307542 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 |
USD 823.00 |
|
TP326045 | Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 |
USD 748.00 |
|
TP326046 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review