NCR1 (NM_001145458) Human Mass Spec Standard

CAT#: PH326814

NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930)

Product Images

Coomassie blue staining of purified NCR1 protein (Cat# TP326814). The protein was produced from HEK293T cells transfected with NCR1 cDNA clone (Cat# RC226814) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226814
• Predicted MW: 32.4 kDa
• Protein Sequence:
  Sequence Link

  >RC226814 representing NM_001145458
  Red=Cloning site Green=Tags(s)
  
  MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD
  RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV
  TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV
  TGDIENTSLAPEDPTFPDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRR
  RLNTQTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138930
• RefSeq ORF: 861
• Synonyms: CD335; LY94; NK-p46; NKP46
• Locus ID: 9437
• UniProt ID: O76036, A0A0A0MR94
• Cytogenetics: 19q13.42
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity