PAFAH1B3 (NM_001145940) Human Mass Spec Standard

CAT#: PH327237

PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139412)

Product Images

Coomassie blue staining of purified PAFAH1B3 protein (Cat# TP327237). The protein was produced from HEK293T cells transfected with PAFAH1B3 cDNA clone (Cat# RC227237) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227237
• Predicted MW: 25.7 kDa
• Protein Sequence:
  Sequence Link

  >RC227237 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF
  GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP
  RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS
  LLLRLLAQDQGQGAPLLEPAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001139412
• RefSeq Size: 869
• RefSeq ORF: 693
• Synonyms: PAFAHG
• Locus ID: 5050
• UniProt ID: Q15102, A0A024R0L6
• Cytogenetics: 19q13.2
• Summary: 'This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Ether lipid metabolism, Metabolic pathways