PAFAH1B3 (NM_002573) Human Recombinant Protein

CAT#: TP301268

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 2

Product Images

Coomassie blue staining of purified PAFAH1B3 protein (Cat# TP301268). The protein was produced from HEK293T cells transfected with PAFAH1B3 cDNA clone (Cat# RC201268) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201268 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF
  GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP
  RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS
  LLLRLLAQDQGQGAPLLEPAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002564
• Locus ID: 5050
• UniProt ID: Q15102, A0A024R0L6
• Cytogenetics: 19q13.2
• Refseq Size: 1086
• Refseq ORF: 693
• Synonyms: PAFAHG
• Summary: This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Ether lipid metabolism, Metabolic pathways