BAP31 (BCAP31) (NM_001139457) Human Mass Spec Standard
CAT#: PH327334
BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227334 |
Predicted MW | 34.6 kDa |
Protein Sequence |
>RC227334 representing NM_001139457
Red=Cloning site Green=Tags(s) MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSL QWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKY DDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESA SEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMR KQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001132929 |
RefSeq ORF | 939 |
Synonyms | 6C6-AG; BAP31; CDM; DDCH; DXS1357E |
Locus ID | 10134 |
UniProt ID | P51572 |
Cytogenetics | Xq28 |
Summary | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401750 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427957 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427962 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401750 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 |
USD 325.00 |
|
LY427957 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 |
USD 325.00 |
|
LY427962 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 |
USD 325.00 |
|
PH304804 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_005736) |
USD 2,055.00 |
|
PH326633 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132913) |
USD 2,055.00 |
|
TP304804 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 |
USD 823.00 |
|
TP326633 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 |
USD 748.00 |
|
TP327334 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review