BAP31 (BCAP31) (NM_005745) Human Recombinant Protein
CAT#: TP304804
Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204804 protein sequence
Red=Cloning site Green=Tags(s) MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI REYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVL AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005736 |
Locus ID | 10134 |
UniProt ID | P51572 |
Cytogenetics | Xq28 |
Refseq Size | 1417 |
Refseq ORF | 738 |
Synonyms | 6C6-AG; BAP31; CDM; DDCH; DXS1357E |
Summary | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401750 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427957 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427962 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401750 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 |
USD 325.00 |
|
LY427957 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 |
USD 325.00 |
|
LY427962 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 |
USD 325.00 |
|
PH304804 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_005736) |
USD 2,055.00 |
|
PH326633 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132913) |
USD 2,055.00 |
|
PH327334 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) |
USD 2,055.00 |
|
TP326633 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 |
USD 748.00 |
|
TP327334 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review