NEIL2 (NM_001135746) Human Mass Spec Standard
CAT#: PH327701
NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_001129218)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227701 |
Predicted MW | 36.8 kDa |
Protein Sequence |
>RC227701 protein sequence
Red=Cloning site Green=Tags(s) MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129218 |
RefSeq Size | 2202 |
RefSeq ORF | 996 |
Synonyms | NEH2; NEI2 |
Locus ID | 252969 |
UniProt ID | Q969S2, A0A024R361 |
Cytogenetics | 8p23.1 |
Summary | This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Base excision repair |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408061 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427692 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427694 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408061 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 1 |
USD 396.00 |
|
LY427692 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 2 |
USD 396.00 |
|
LY427694 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 4 |
USD 396.00 |
|
PH300913 | NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_659480) |
USD 2,055.00 |
|
TP300913 | Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 1 |
USD 823.00 |
|
TP327701 | Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review