Neuropeptide Y / NPY Human, Rat Protein

CAT#: AR31131PU-L

Neuropeptide Y / NPY human, rat protein, 1.0 mg

Specifications

Product Data

• Species: Human, Rat
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-CONH2 (1-Letter code).
  H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (3-Letter code).
• Predicted MW: 4271.66 Da
• Purity: >95% by HPLC
• Buffer: State: Purified peptide
• Preparation: Purified peptide
• Protein Description: Neuropeptide Y (Human, Rat).
  Formula: C₁₈₉H₂₈₅N₅₅O₅₇S
• Storage: Upon receipt, store undiluted (in aliquots) at -20°C.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: One year from despatch.

Reference Data

• RefSeq: NP_000896
• Locus ID: 4852
• UniProt ID: P01303, A4D158
• Cytogenetics: 7p15.3
• Synonyms: PYY4
• Summary: 'This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway