FGF basic / FGF2 Human Protein

CAT#: DA3503XC

FGF basic / FGF2 human recombinant protein, 50 µg


USD 250.00

2 Weeks*

Size
    • 50 ug

Product Images

Other products for "FGF2"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRGQYKLGSKTGPGQKAILFLPMSAKS
Predicted MW 16.5 kDa
Purity >98% by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS
Stabilizer: None
Bioactivity Biological: The ED50 for stimulation of cell proliferation in Human umbilical vein endothelial cells by Human FGF-2 (basic) has been determined to be in the range of 0.1-2 ng/ml.
Endotoxin < 0.1 ng per µg of FGF-basic
Reconstitution Restore in water containing at least 0.1% Human or Bovine Serum Albumin to a concentration not lower than 10 μg/ml.
Preparation Lyophilized purified protein
Protein Description Recombinant Human Fibroblast Growth Factor-2 (basic).
Result by N-terminal sequencing: AGSITTL
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001997
Locus ID 2247
UniProt ID P09038
Cytogenetics 4q28.1
Synonyms BFGF; FGF-2; FGFB; HBGF-2
Summary 'The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.