LMCD1 (NM_014583) Human Recombinant Protein
CAT#: TP300062
Recombinant protein of human LIM and cysteine-rich domains 1 (LMCD1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200062 protein sequence
Red=Cloning site Green=Tags(s) MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT KGQLLCPTCSKSKRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055398 |
Locus ID | 29995 |
UniProt ID | Q9NZU5 |
Cytogenetics | 3p25.3 |
Refseq Size | 1757 |
Refseq ORF | 1095 |
Summary | This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402349 | LMCD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402349 | Transient overexpression lysate of LIM and cysteine-rich domains 1 (LMCD1) |
USD 396.00 |
|
PH300062 | LMCD1 MS Standard C13 and N15-labeled recombinant protein (NP_055398) |
USD 2,055.00 |
|
TP721018 | Purified recombinant protein of Human LIM and cysteine-rich domains 1 (LMCD1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review