LMCD1 (NM_014583) Human Recombinant Protein
CAT#: TP721018
Purified recombinant protein of Human LIM and cysteine-rich domains 1 (LMCD1)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDP
|
Tag | N, C-His |
Predicted MW | 44 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055398 |
Locus ID | 29995 |
UniProt ID | Q9NZU5 |
Cytogenetics | 3p25.3 |
Refseq Size | 1757 |
Refseq ORF | 1095 |
Synonyms | dyxin; LIM and cysteine-rich domains 1 |
Summary | This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402349 | LMCD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402349 | Transient overexpression lysate of LIM and cysteine-rich domains 1 (LMCD1) |
USD 325.00 |
|
PH300062 | LMCD1 MS Standard C13 and N15-labeled recombinant protein (NP_055398) |
USD 2,055.00 |
|
TP300062 | Recombinant protein of human LIM and cysteine-rich domains 1 (LMCD1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review