NDUFB9 (NM_005005) Human Recombinant Protein
CAT#: TP300223
Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200223 protein sequence
Red=Cloning site Green=Tags(s) MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEE FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQL QEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004996 |
Locus ID | 4715 |
UniProt ID | Q9Y6M9 |
Cytogenetics | 8q24.13 |
Refseq Size | 736 |
Refseq ORF | 537 |
Synonyms | B22; CI-B22; LYRM3; MC1DN24; UQOR22 |
Summary | The protein encoded by this gene is a subunit of the mitochondrial oxidative phosphorylation complex I (nicotinamide adenine dinucleotide: ubiquinone oxidoreductase). Complex I is localized to the inner mitochondrial membrane and functions to dehydrogenate nicotinamide adenine dinucleotide and to shuttle electrons to coenzyme Q. Complex I deficiency is the most common defect found in oxidative phosphorylation disorders and results in a range of conditions, including lethal neonatal disease, hypertrophic cardiomyopathy, liver disease, and adult-onset neurodegenerative disorders. Pseudogenes of this gene are found on chromosomes five, seven and eight. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417578 | NDUFB9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417578 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9) |
USD 325.00 |
|
PH300223 | NDUFB9 MS Standard C13 and N15-labeled recombinant protein (NP_004996) |
USD 2,055.00 |
|
TP761751 | Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9), nuclear gene encoding mitochondrial protein, full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review