ATG4B (NM_013325) Human Recombinant Protein
CAT#: TP300289
Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200289 protein sequence
Red=Cloning site Green=Tags(s) MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE LVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037457 |
Locus ID | 23192 |
UniProt ID | Q9Y4P1, B3KVU2 |
Cytogenetics | 2q37.3 |
Refseq Size | 2892 |
Refseq ORF | 1179 |
Synonyms | APG4B; AUTL1 |
Summary | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Protease |
Protein Pathways | Regulation of autophagy |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403600 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415627 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429376 | ATG4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403600 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 2 |
USD 325.00 |
|
LY415627 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1 |
USD 325.00 |
|
LY429376 | Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1 |
USD 325.00 |
|
PH300289 | ATG4B MS Standard C13 and N15-labeled recombinant protein (NP_037457) |
USD 2,055.00 |
|
PH316453 | ATG4B MS Standard C13 and N15-labeled recombinant protein (NP_847896) |
USD 2,055.00 |
|
TP316453 | Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review