Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Recombinant Protein
CAT#: TP300321
Recombinant protein of human angiopoietin-like 7 (ANGPTL7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200321 protein sequence
Red=Cloning site Green=Tags(s) MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066969 |
Locus ID | 10218 |
UniProt ID | O43827 |
Cytogenetics | 1p36.22 |
Refseq Size | 2307 |
Refseq ORF | 1038 |
Synonyms | AngX; CDT6; dJ647M16.1 |
Summary | Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (PubMed:21199193). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402846 | ANGPTL7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402846 | Transient overexpression lysate of angiopoietin-like 7 (ANGPTL7) |
USD 396.00 |
|
PH300321 | ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review