CD70 (NM_001252) Human Recombinant Protein
CAT#: TP300410
Recombinant protein of human CD70 molecule (CD70)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200410 protein sequence
Red=Cloning site Green=Tags(s) MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | In vitro binding assay (PMID: 25730144) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001243 |
| Locus ID | 970 |
| UniProt ID | P32970, A0A0U5JA32 |
| Cytogenetics | 19p13.3 |
| Refseq Size | 913 |
| Refseq ORF | 579 |
| Synonyms | CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A |
| Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400501 | CD70 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400501 | Transient overexpression lysate of CD70 molecule (CD70) |
USD 436.00 |
|
| PH300410 | CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243) |
USD 2,055.00 |
|
| TP700287 | Purified recombinant protein of human CD70 molecule (CD70), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP723392 | Purified recombinant protein of Human CD70 molecule (CD70). |
USD 140.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China