CD70 (NM_001252) Human Recombinant Protein
CAT#: TP723392
Purified recombinant protein of Human CD70 molecule (CD70).
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | CHO |
| Expression cDNA Clone or AA Sequence |
HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
|
| Tag | N-His |
| Predicted MW | 19 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: results may vary with PBMC donors. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001243 |
| Locus ID | 970 |
| UniProt ID | P32970, A0A0U5JA32 |
| Cytogenetics | 19p13.3 |
| Refseq Size | 913 |
| Refseq ORF | 579 |
| Synonyms | CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A |
| Summary | 'The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]' |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400501 | CD70 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400501 | Transient overexpression lysate of CD70 molecule (CD70) |
USD 436.00 |
|
| PH300410 | CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243) |
USD 2,055.00 |
|
| TP300410 | Recombinant protein of human CD70 molecule (CD70), 20 µg |
USD 564.00 |
|
| TP700287 | Purified recombinant protein of human CD70 molecule (CD70), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China