PKC zeta (PRKCZ) (NM_001033581) Human Recombinant Protein
CAT#: TP300438
Recombinant protein of human protein kinase C, zeta (PRKCZ), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200438 representing NM_001033581
Red=Cloning site Green=Tags(s) MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028753 |
Locus ID | 5590 |
UniProt ID | Q05513 |
Cytogenetics | 1p36.33 |
Refseq Size | 2147 |
Refseq ORF | 1776 |
Synonyms | PKC-ZETA; PKC2 |
Summary | Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Endocytosis, Insulin signaling pathway, Tight junction, Type II diabetes mellitus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400967 | PRKCZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422406 | PRKCZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425579 | PRKCZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400967 | Transient overexpression lysate of protein kinase C, zeta (PRKCZ), transcript variant 1 |
USD 396.00 |
|
LY422406 | Transient overexpression lysate of protein kinase C, zeta (PRKCZ), transcript variant 3 |
USD 396.00 |
|
LY425579 | Transient overexpression lysate of protein kinase C, zeta (PRKCZ), transcript variant 3 |
USD 396.00 |
|
PH300438 | PRKCZ MS Standard C13 and N15-labeled recombinant protein (NP_001028753) |
USD 2,055.00 |
|
PH302472 | PRKCZ MS Standard C13 and N15-labeled recombinant protein (NP_002735) |
USD 2,055.00 |
|
TP302472 | Recombinant protein of human protein kinase C, zeta (PRKCZ), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review